Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon...
26 KB (3,386 words) - 20:05, 10 September 2024
The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...
33 KB (4,103 words) - 15:05, 2 October 2024
Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 analogs, GLP-1DAs or incretin mimetics, are a class of anorectic drugs that reduce...
38 KB (3,935 words) - 21:33, 20 September 2024
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...
2 KB (258 words) - 20:23, 20 December 2023
Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...
24 KB (2,820 words) - 17:52, 15 September 2024
Semaglutide (category Peptide therapeutics)
used for long-term weight management. It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered...
68 KB (5,595 words) - 15:33, 1 October 2024
glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide-1 receptor (GLP-1R) – binds Glucagon-like peptide-1...
367 bytes (75 words) - 20:07, 20 August 2024
Gastric inhibitory polypeptide (redirect from Gastrointestinal inhibitory peptide)
incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins,...
9 KB (1,052 words) - 16:12, 2 May 2024
The hormone Glucagon-like Peptide 1 can lessen the brain's inflamed reaction caused by amyloid beta oxidative stress. Glucagon-like Peptide 1 can also increase...
25 KB (2,527 words) - 09:18, 30 September 2024
2006). "Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon receptor antagonist". The Journal...
25 KB (3,112 words) - 17:33, 17 August 2024